PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa12g065340.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HB-other
Protein Properties Length: 1120aa    MW: 126754 Da    PI: 7.7414
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa12g065340.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.41.4e-09551854
                    -HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  8 tkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRak 54
                    ++ q+++Le+++ ++ yp+ +e+e++ k+lgLt + V+ WF+ r  +
  Csa12g065340.1  5 SPVQVQALEAFYFEQIYPTPKEMEDMGKSLGLTVKEVRGWFKRRTSR 51
                    788**************************************988666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.483155IPR001356Homeobox domain
SMARTSM003891.6E-4159IPR001356Homeobox domain
CDDcd000867.36E-8348No hitNo description
SuperFamilySSF466892.95E-8353IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-9447IPR009057Homeodomain-like
PfamPF000463.7E-7551IPR001356Homeobox domain
PROSITE profilePS5082712.255349408IPR018501DDT domain
SMARTSM005713.1E-10349408IPR018501DDT domain
PfamPF027916.0E-9350403IPR018501DDT domain
PfamPF156126.2E-7629669IPR028942WHIM1 domain
PfamPF156139.5E-11752825IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1120 aa     Download sequence    Send to blast
MKRKSPVQVQ ALEAFYFEQI YPTPKEMEDM GKSLGLTVKE VRGWFKRRTS RGKGMISPAD  60
DVVGAENPQS YNTSRIRTSR CDFRAVVKKI SSVETRKANC QELFTSQHIL AKIFRKDGPT  120
LGSEFDHPSS GARKASWLGT SSVEQQKQRM TRKRKISELM DHTSQDCVQE NATVMKHGIG  180
KGLMTVWRVM NPNRRDVSPC VGLLGERATL PQSSARNPPH QKKKQRQLAS ILKQKLLQKR  240
STEKKRRSIN REVELNKDET QRAFKEHCDL AVDREVFKET CQTTSILVDD EELEMRERQE  300
RGNPLTCSCH HSSSGSHGCF LCKDLLPKFP PNSVQMRVPF GLHPWNSFPE TVKKLFKVVH  360
FLYTYSVTLD ICPFTLDELT RAFHDKDSLL LGKIHLSLLK LLLLDVETEL QRGYFSNLSI  420
SCKFLALLQS VESQILILDL WKDSLNSLTW TEILRQILVA AGYGSVKGAV QSEELSKERR  480
LMKKYGLHLG TLKGELFRML NEQGNNGLKI SELANAPEVA VLNLATAQEE RENSICSTLA  540
SDITLFEKIS ESTYRVRVNC FSEDLDKSQS DSDASGSVDD ESDTCSVSSG DDIEHVSENS  600
ALRKVKCRKR RKHKSKMREL CSEIDESHPG EPWLLGLMEG EYSDLSIEEK LDVFVALIEL  660
LSSGSTIRME DLPRAIVDCV PSIYSHGSGG KIKRSSSNQC SYPRGSWVHG GELPGIKALS  720
KSSDSHPVDS SSVVGDFANL AGDNANNVHP MQSVYLGSDR RFNRYWLFLG TCNANDPGHR  780
CVFFESSEDG HWEVINNKEA LRVLLSVLDD RGRREARLVE SLEKRESFLC QAMLSGQVTQ  840
SERSHFTDIV REDSSSPVSD IDNNLCLSEI ANDQFSSQHA AIVFEIGSKR EKSLLWSLLQ  900
EFDEWIWANF NFNLSAVKHR RRSYLDSLIR CKSCHDLYWR DEKHCKICHA TFEVDIDVEE  960
RYAIHAATCS KKEECDTFPD HKVLSSQLQS LKAAVYAIES AMPEDALIGA WRKSAHRLWA  1020
KRLRRSSTVS EITQVIGDFV GAINEDWLWH SSDQGHSNAL LGETISCFPS MPQTTSAMAL  1080
WLVKLDTLIA PYVEKAQPER NQLLCRTRNT SRRASRREL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL0496400.0AL049640.1 Arabidopsis thaliana DNA chromosome 4, BAC clone T20K18 (ESSA project).
GenBankAL1615340.0AL161534.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 34.
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010450236.10.0PREDICTED: uncharacterized protein LOC104732396
RefseqXP_010450235.10.0PREDICTED: uncharacterized protein LOC104732396
SwissprotF4JRF50.0RLT3_ARATH; Homeobox-DDT domain protein RLT3
TrEMBLR0GUF40.0R0GUF4_9BRAS; Uncharacterized protein
STRINGAT4G12750.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM96382125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12750.10.0Homeodomain-like transcriptional regulator